PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv1_013750_smoy.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family bZIP
Protein Properties Length: 305aa    MW: 34711.2 Da    PI: 4.5043
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv1_013750_smoy.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_124.17.8e-08141184346
                         XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLk 46 
                          +k+ +r  +NR AA rsR+RKk +++ Le k+  +eae ++L 
  Bv1_013750_smoy.t1 141 LSKKRKRQLRNRDAAMRSRERKKIYVKDLEMKSRYMEAECRRLG 184
                         57999*********************************998664 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.5E-10137198No hitNo description
SMARTSM003380.0069139203IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.461141183IPR004827Basic-leucine zipper domain
PfamPF077162.3E-7142183IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.09E-10143198No hitNo description
CDDcd147041.16E-13144195No hitNo description
PROSITE patternPS000360146161IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0030968Biological Processendoplasmic reticulum unfolded protein response
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MELNEIDWEH MFEEDGFDIF KDVSTSLEEE NTGTAINTVD SWIEELLMNG DEEAGVGVEL  60
GNDFMWSDLL LDSPLEDRQP SDERESLEDK SSPSCSNSEV NVKITSNYTN DNSGEDIPNF  120
ESNNKSEDDV LELHDTDSDP LSKKRKRQLR NRDAAMRSRE RKKIYVKDLE MKSRYMEAEC  180
RRLGRLLQCC YAENQMLRIS LGSAYGASMA KPESAVLLLE SLLLVSLVWL MVNMCLLPLP  240
KMPLLSQDAV PQGNGERKEP ESAATNGKRT KVTELWLTYS FMKSKRCRGS RIKMKSVIDR  300
GLLSI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1143162KRKRQLRNRDAAMRSRERKK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00019PBMTransfer from AT1G42990Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010684737.10.0PREDICTED: bZIP transcription factor 60
TrEMBLA0A0J8D5B40.0A0A0J8D5B4_BETVU; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G42990.17e-15basic region/leucine zipper motif 60